Edit |   |
---|---|
Antigenic Specificity | ATP6V1A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ATP6V1A polyclonal antibody, unconjugated |
Immunogen | ATP6 V6 antibody was raised using the N terminal of ATP6 6 corresponding to a region with amino acids SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR |
Other Names | ATP6A1|ATP6V1A1|HO68|VA68|VPP2|Vma1|ATPase|H+ transporting|lysosomal|subunit A1|H(+)-transporting two-sector ATPase|subunit A|H+-transporting ATPase chain A|vacuolar (VA68 type)|V-ATPase 69 kDa subunit 1|V-ATPase A subunit 1|V-ATPase subunit A|V-type proton ATPase catalytic subunit A|vacuolar ATP synthase catalytic subunit A|ubiquitous isoform|vacuolar ATPase isoform VA68|vacuolar proton pump alpha subunit 1|vacuolar proton pump subunit alpha|ATPase H+ transporting V1 subunit A|ATP6V1A|ATPase, H+ Transporting, Lysosomal 70kDa, V1 Subunit A|lysosomal (vacuolar proton pump)|alpha polypeptide|70kD|lysosomal V1 subunit A|H(+)-ATPase subunit A|V-ATPase 69 kDa subunit|vacuolar H+-ATPase A subunit|AI647066|Atp6a2|70-kDa subunit|V1 subunit A|V1 subunit A1|alpha 70 kDa|lysosomal 70kD|lysosomal 70kDa|ATPase, H+ transporting, lysosomal V1 subunit A|atp6v1al|zgc:63516|like|ATPase, H+ transporting, lysosomal, V1 subunit Aa|atp6v1aa|A2 isoform of vacuolar H+-ATPase subunit A|H+ ATPase|An02g10440|ANI_1_1468024|AO090102000349|AOR_1_602134|vacuolar ATP synthase subunit A|VHA-A|v1a|ATPase H+ transporting V1 subunit A L homeolog|atp6v1a.L|IDP1607|IDP1607a|IDP1607c|IDP1662|IDP2575|IDP2575a|IDP2575c|PCO134411|PCO134411(361)|PCO134411_ov|PZA00936|V-ATPase|V-type H+-ATPase|nPZA00936-1|vacuolar ATPase 69 kDa subunit|vpp*-U36436|vacuolar proton pump 3|vpp3|CG12403|DmelCG12403|Vha|Vha-68-1|Vha68|vha67-2|vha68-1|CG12403-PA|CG12403-PB|Vha68-1-PA|Vha68-1-PB|vacuolar H+ ATPase subunit 68-1|Vacuolar H[+] ATPase 68kD subunit 1 |
Gene, Accession # | Gene ID: 523, 11964, 685232 |
Catalog # | ABIN631586 |
Price | $1020 |
Order / More Info | ATP6V1A Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |