Edit |   |
---|---|
Antigenic Specificity | SCYL3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SCYL3 polyclonal antibody, unconjugated |
Immunogen | SCYL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV |
Other Names | PACE-1|PACE1|SCY1-like protein 3|ezrin-binding partner PACE-1 (PACE-1)|ezrin-binding protein PACE-1|protein-associating with the carboxyl-terminal domain of ezrin|SCY1 like pseudokinase 3|SCYL3|SCY1-Like 3|1200016D23Rik|6030457O16|AW214499|ezrin-binding partner PACE-1|SCY1-like 3 (S. cerevisiae)|wu:faa95c04|wu:fc11d06|zgc:55575|SCY1-like, kinase-like 3|RGD1308992|MGC81481|SCY1 like pseudokinase 3 L homeolog|scyl3.L|rp1-97p20.2|protein-associating with the carboxyl-terminal domain of ezrin-like |
Gene, Accession # | Gene ID: 57147, 240880 |
Catalog # | ABIN631591 |
Price | $1020 |
Order / More Info | SCYL3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |