Edit |   |
---|---|
Antigenic Specificity | ODF2L |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ODF2L polyclonal antibody, unconjugated |
Immunogen | ODF2 L antibody was raised using the N terminal of ODF2 corresponding to a region with amino acids KTVALKKASKVYKQRLDHFTGAIEKLTSQIRDQEAKLSETISASNAWKSH |
Other Names | 4733401D09Rik|9630045K08Rik|D3Ertd250e|outer dense fiber protein 2-like|outer dense fiber of sperm tails 2-like|Odf2l|RP5-977L11.1|dJ977L11.1|outer dense fiber of sperm tails 2 like|RGD1308397|outer dense fiber of sperm tails 2-like L homeolog|odf2l.L|im:7137744|wu:fc04b05|outer dense fiber of sperm tails 2b|odf2b|LOC100366442 |
Gene, Accession # | Gene ID: 57489, 685425 |
Catalog # | ABIN632872 |
Price | $1020 |
Order / More Info | ODF2L Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |