Edit |   |
---|---|
Antigenic Specificity | VDAC1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-VDAC1 polyclonal antibody, unconjugated |
Immunogen | VDAC1 antibody was raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA |
Other Names | PORIN|VDAC-1|outer mitochondrial membrane protein porin 1|plasmalemmal porin|porin 31HL|porin 31HM|voltage-dependent anion-selective channel protein 1|voltage dependent anion channel 1|VDAC1|Voltage-Dependent Anion Channel 1|AL033343|Vdac5|VDAC-5|mVDAC1|mVDAC5|voltage-dependent anion-selective channel protein 5|rVDAC1|BR1-VDAC|brain-derived voltage-dependent anion channel 1|fa13f11|wu:fa13f11|zgc:85830|voltage-dependent anion channel 1 S homeolog|vdac1.S|5076|ARABIDOPSIS THALIANA VOLTAGE DEPENDENT ANION CHANNEL 1|ATVDAC1|T22N4.9|T22N4_9|voltage-dependent anion-selective channel protein 1 pseudogene|LOC100349915 |
Gene, Accession # | Gene ID: 7416, 22333, 83529, 474681 |
Catalog # | ABIN630114 |
Price | $902 |
Order / More Info | VDAC1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |