Edit |   |
---|---|
Antigenic Specificity | POLR3B |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | Drosophila melanogaster, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-POLR3B polyclonal antibody, unconjugated |
Immunogen | POLR3 B antibody was raised using the C terminal of POLR3 corresponding to a region with amino acids IEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQED |
Other Names | C128|HLD8|RPC2|DNA-directed RNA polymerase III 127.6 kDa polypeptide|DNA-directed RNA polymerase III subunit B|DNA-directed RNA polymerase III subunit RPC2|RNA polymerase III subunit C2|RNA polymerase III subunit B|POLR3B|Polymerase (RNA) III (DNA Directed) Polypeptide B|2700078H01Rik|A330032P03Rik|C85372|DNA-directed RNA polymerase III B|RNA polymerase III subunit RPC2 homolog|RGD1565311|si:dkey-103i16.3|wu:fc20h06|slim jim|slj|polymerase (RNA) III subunit B|LOC100521623 |
Gene, Accession # | Gene ID: 55703, 70428, 362858 |
Catalog # | ABIN630870 |
Price | $1020 |
Order / More Info | POLR3B Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |