Edit |   |
---|---|
Antigenic Specificity | Lipase |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Lipase polyclonal antibody, unconjugated |
Immunogen | Lipase antibody (Gastric) was raised using the N terminal of LIPF corresponding to a region with amino acids ISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQH |
Other Names | EDL|EL|PRO719|endothelial cell-derived lipase|endothelial lipase|lipoprotein lipase H|lipase G, endothelial type|LIPG|Lipase|lipase G|3110013K01Rik|mEDL|lipose|endothelial|lipase, endothelial|endothelial-derived lipase |
Gene, Accession # | Gene ID: 9388 |
Catalog # | ABIN633941 |
Price | $1020 |
Order / More Info | Lipase Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |