Edit |   |
---|---|
Antigenic Specificity | RORA |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat, zebrafish |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RORA polyclonal antibody, unconjugated |
Immunogen | RORA antibody was raised using the middle region of RORA corresponding to a region with amino acids GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP |
Other Names | NR1F1|ROR1|ROR2|ROR3|RZR-ALPHA|RZRA|ROR-alpha|nuclear receptor ROR-alpha|nuclear receptor RZR-alpha|nuclear receptor subfamily 1 group F member 1|retinoic acid receptor-related orphan receptor alpha|retinoid-related orphan receptor alpha|thyroid hormone nuclear receptor alpha variant 4|transcription factor RZR-alpha|RAR related orphan receptor A|RORA|RAR-Related Orphan Receptor A|RAR-related orphan receptor alpha|MGC146531|9530021D13Rik|nmf267|sg|staggerer|tmgc26|retinoid-related orphan receptor-alpha|RORalpha1|RORalpha-B|gb:dq017624|rora2|NR1F1-B|retinoid-related orphan receptor alpha 2|RAR-related orphan receptor A, paralog a|roraa |
Gene, Accession # | Gene ID: 6095, 19883, 300807, 478328, 564951 |
Catalog # | ABIN629579 |
Price | $902 |
Order / More Info | RORA Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |