Edit |   |
---|---|
Antigenic Specificity | TAB1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-TAB1 polyclonal antibody, unconjugated |
Immunogen | MAP3 K3 P1 antibody was raised using the N terminal of MAP3 3 P1 corresponding to a region with amino acids MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPE |
Other Names | 3'-Tab1|MAP3K7IP1|TAK1-binding protein 1|TGF-beta-activated kinase 1 and MAP3K7-binding protein 1|mitogen-activated protein kinase kinase kinase 7-interacting protein 1|transforming growth factor beta-activated kinase-binding protein 1|TGF-beta activated kinase 1 (MAP3K7) binding protein 1|TAB1|TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 1|2310012M03Rik|b2b449Clo|TGF-beta-activated kinase 1-binding protein 1|beta activated kinase-1 binding protein-1|mitogen activated protein kinase kinase kinase 7 interacting protein 1|mitogen-activated protein kinase kinase kinase 7 interacting protein 1|LOW QUALITY PROTEIN: TGF-beta-activated kinase 1 and MAP3K7-binding protein 1|TGF-beta activated kinase 1MAP3K7 binding protein 1 L homeolog|TGF-beta activated kinase 1/MAP3K7 binding protein 1 L homeolog|tab1.L |
Gene, Accession # | Gene ID: 10454, 66513, 315139 |
Catalog # | ABIN634348 |
Price | $1020 |
Order / More Info | TAB1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |