Edit |   |
---|---|
Antigenic Specificity | TUBB4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-TUBB4 polyclonal antibody, unconjugated |
Immunogen | Beta Tubulin 4 antibody was raised using the N terminal of TUBB4 corresponding to a region with amino acids TYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQI |
Other Names | DYT4|HLD6|TUBB4|TUBB5|beta-5|class IVa beta-tubulin|tubulin 5 beta|tubulin beta-4 chain|tubulin beta-4A chain|tubulin|beta 4 class IVa|beta|5|tubulin beta 4A class IVa|TUBB4A|Tubulin beta 4a|AI325297|M(beta)4|Tubb|beta 4|tubulin, beta 4A class IVA|tubulin beta 4A class IVa S homeolog|tubulin beta5|beta 4A class IVa|tubb4a.S |
Gene, Accession # | Gene ID: 10382 |
Catalog # | ABIN633077 |
Price | $1020 |
Order / More Info | TUBB4 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |