Edit |   |
---|---|
Antigenic Specificity | ST3GAL3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ST3GAL3 polyclonal antibody, unconjugated |
Immunogen | ST3 GAL3 antibody was raised using the C terminal of ST3 AL3 corresponding to a region with amino acids GFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITD |
Other Names | EIEE15|MRT12|SIAT6|ST3GALII|ST3GalIII|ST3N|CMP-N-acetylneuraminate-beta-1|4-galactoside alpha-2|3-sialyltransferase|Gal beta-1|3(4)GlcNAc alpha-2|3 sialyltransferase|ST3Gal III|alpha 2|3-ST 3|3-sialyltransferase III|alpha-2|3-sialyltransferase II|sialyltransferase 6 (N-acetyllacosaminide alpha 2|3-sialyltransferase)|ST3 beta-galactoside alpha-2,3-sialyltransferase 3|ST3GAL3|Siat3|N-acetyllactosaminide alpha-2|beta-galactoside alpha-2|3-sialyltransferase 3|3(4) GlcNAc alpha-2|sialyltransferase (N-acetyllacosaminide alpha 2|sialyltransferase 3|N-acetyllacosaminide alpha 2|sialyltransferase (N-acetyllacosaminide alpha 23-sialyltransferase)|sialyltransferase 6(N-acetyllacosaminide alpha 23-sialyltransferase)|zgc:63978|ST3 beta-galactoside alpha-2|st3gal3-r2|ST3 beta-galactoside alpha-2,3-sialyltransferase 3a|st3gal3a|st3Gal-III|alpha2|ST3 beta-galactoside alpha-2,3-sialyltransferase 3 S homeolog|st3gal3.S|3-sialyltransferase ST3Gal III|sialyltransferase 6|sialyltransferase ST3Gal-III|3- sialyltransferase |
Gene, Accession # | Gene ID: 6487, 20441, 64445 |
Catalog # | ABIN630406 |
Price | $902 |
Order / More Info | ST3GAL3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |