Edit |   |
---|---|
Antigenic Specificity | SLC1A1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SLC1A1 polyclonal antibody, unconjugated |
Immunogen | SLC1 A1 antibody was raised using the N terminal Of Slc1 1 corresponding to a region with amino acids VLVREHSNLSTLEKFYFAFPGEILMRMLKLIILPLIISSMITGVAALDSN |
Other Names | EAAC1|EAAT3|SCZD18|excitatory amino acid carrier 1|excitatory amino acid transporter 3|neuronal and epithelial glutamate transporter|sodium-dependent glutamateaspartate transporter 3|solute carrier family 1 member 1|SLC1A1|Solute Carrier Family 1 (Neuronal/epithelial High Affinity Glutamate Transporter, System Xag), Member 1|D130048G10Rik|EAAC2|MEAAC1|excitatory amino acid carrier 2|excitatory amino-acid carrier 1|glutamate transporter mEAAC2|solute carrier family 1|member 1|REAAC1|Solute carrier family 1 A1 (brain glutamate transporter)|excitatory amino acid transporter-3|GB16911|LOC412382|SLC1A2a|zgc:91959|CpipJ_CPIJ000674|CpipJ_CPIJ001134|renal high affinity glutamate transporter EAAC1|high-affinity glutamate transporter|glutamate transporter |
Gene, Accession # | Gene ID: 6505 |
Catalog # | ABIN635938 |
Price | $1020 |
Order / More Info | SLC1A1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |