Edit |   |
---|---|
Antigenic Specificity | SCN5A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat, zebrafish |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SCN5A polyclonal antibody, unconjugated |
Immunogen | SCN5 A antibody was raised using the C terminal of SCN5 corresponding to a region with amino acids FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAM |
Other Names | CDCD2|CMD1E|CMPD2|HB1|HB2|HBBD|HH1|ICCD|IVF|LQT3|Nav1.5|PFHB1|SSS1|VF1|cardiac tetrodotoxin-insensitive voltage-dependent sodium channel alpha subunit|sodium channel protein cardiac muscle subunit alpha|sodium channel protein type 5 subunit alpha|voltage-gated sodium channel subunit alpha Nav1.5|sodium voltage-gated channel alpha subunit 5|SCN5A|Sodium Channel, Voltage-Gated, Type V, alpha Subunit|Nav1.5c|SkM1|SkM2|mH1|sodium channel protein type V subunit alpha|sodium channel voltage-gated type V alpha polypeptide|sodium channel|voltage-gated|type V|alpha polypeptide|sodium channel, voltage-gated, type V, alpha|SCAL|type 5|alpha subunit|voltage-gated sodium channel Nav1.5c|oltage-gated sodium channel type V alpha|voltage-dependent sodium channel SCN10A|voltage-gated sodium channel H|cardiac sodium channel|sodium channel alpha subunit|alpha (long QT syndrome 3)|voltage-gated sodium channel alpha subunit|voltage-gated sodium channel type V alpha|voltage-gated sodium channel cardiac isoform Nav1.5|alpha polypeptide (long (electrocardiographic) QT syndrome 3)|voltage-gated sodium channel type V alpha polypeptide|NaV1.5 cardiac voltage-gated sodium channel alpha subunit|LOW QUALITY PROTEIN: sodium channel protein type 5 subunit alpha |
Gene, Accession # | Gene ID: 6331, 20271, 25665, 403497 |
Catalog # | ABIN633685 |
Price | $1020 |
Order / More Info | SCN5A Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |