Edit |   |
---|---|
Antigenic Specificity | GGA3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-GGA3 polyclonal antibody, unconjugated |
Immunogen | GGA3 antibody was raised using the N terminal of GGA3 corresponding to a region with amino acids AKLLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLL |
Other Names | ADP-ribosylation factor-binding protein GGA3|Golgi-localized|gamma ear-containing|ARF-binding protein 3|golgi associated|gamma adaptin ear containing|ARF binding protein 3|golgi associated, gamma adaptin ear containing, ARF binding protein 3|GGA3|Golgi-Associated, gamma Adaptin Ear Containing, ARF Binding Protein 3|C230037M19Rik|mKIAA0154|ADP-ribosylation factor binding protein 3|im:7144559|si:ch211-108p22.4|ggolgi-associated|ggolgi-associated, gamma adaptin ear containing, ARF binding protein 3 |
Gene, Accession # | Gene ID: 23163 |
Catalog # | ABIN631698 |
Price | $1020 |
Order / More Info | GGA3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |