Edit |   |
---|---|
Antigenic Specificity | APOO |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-APOO polyclonal antibody, unconjugated |
Immunogen | FAM121 B antibody was raised using the C terminal Of Fam121 corresponding to a region with amino acids LYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK |
Other Names | fam121b|fp74f12|wu:fp74f12|zgc:123314|apolipoprotein O|family with sequence similarity 121B|apolipoprotein O, a|apooa|APOO|my025|brain my025|0610008C08Rik|1110019O03Rik|RGD1565289|MGC79016|apolipoprotein O L homeolog|apoo.L |
Gene, Accession # | Gene ID: 79135 |
Catalog # | ABIN630052 |
Price | $902 |
Order / More Info | APOO Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |