Edit |   |
---|---|
Antigenic Specificity | RPL3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RPL3 polyclonal antibody, unconjugated |
Immunogen | RPL3 antibody was raised using the C terminal of RPL3 corresponding to a region with amino acids YHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHY |
Other Names | ASC-1|L3|TARBP-B|60S ribosomal protein L3|HIV-1 TAR RNA-binding protein B|hypothetical protein|ribosomal protein L3|RPL3|L4|F2|J1|ribosomal protein L3 homolog|rpl-3|wu:fa99g02|wu:fb65e09|zgc:110350|ribosomal protein L3 L homeolog|rpl3.L|50S ribosomal protein L3|CG4863|DmelCG4863|anon-EST:GressD4|CG4863-PA|CG4863-PD|CG4863-PG|CG4863-PH|RpL3-PA|RpL3-PD|RpL3-PG|RpL3-PH |
Gene, Accession # | Gene ID: 6122, 27367, 300079 |
Catalog # | ABIN633286 |
Price | $1020 |
Order / More Info | RPL3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |