Edit |   |
---|---|
Antigenic Specificity | ATP6V1C1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ATP6V1C1 polyclonal antibody, unconjugated |
Immunogen | ATP6 V6 1 antibody was raised using the N terminal of ATP6 6 1 corresponding to a region with amino acids MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNG |
Other Names | ATP6C|ATP6D|VATC|Vma5|H(+)-transporting two-sector ATPase|subunit C|H+ -ATPase C subunit|H+-transporting ATPase chain C|vacuolar|V-ATPase C subunit|V-ATPase subunit C 1|V-type proton ATPase subunit C 1|subunit C of vacuolar proton-ATPase V1 domain|vacuolar ATP synthase subunit C|vacuolar proton pump C subunit|vacuolar proton pump subunit C 1|vacuolar proton pump|42-kD subunit|vacuolar proton-ATPase|VI domain|ATPase H+ transporting V1 subunit C1|ATP6V1C1|ATPase, H+ Transporting, Lysosomal 42kDa, V1 Subunit C1|1700025B18Rik|U13839|ATPase|H+ transporting|V1 subunit C|ATPase, H+ transporting, lysosomal V1 subunit C1|vacuolar H+ -ATPase C subunit|lysosomal V1 subunit C1|lysosomal 42kDa|V1 subunit C1|ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 L homeolog|atp6v1c1.L|V-type proton ATPase subunit C 1-like|si:zc215i13.2|wu:fd12h05|lysosomal|V-ATPase subunit C 1-A|V-type proton ATPase subunit C 1-A|vacuolar proton pump subunit C 1-A|ATPase, H+ transporting, lysosomal, V1 subunit C1a|atp6v1c1a|atp6v1c1l|zgc:92684|isoform 1|like|V-ATPase subunit C 1-B|V-type proton ATPase subunit C 1-B|vacuolar proton pump subunit C 1-B|ATPase, H+ transporting, lysosomal, V1 subunit C1b|atp6v1c1b |
Gene, Accession # | Gene ID: 528, 66335, 299971 |
Catalog # | ABIN631307 |
Price | $1020 |
Order / More Info | ATP6V1C1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |