Edit |   |
---|---|
Antigenic Specificity | SRD5A2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SRD5A2 polyclonal antibody, unconjugated |
Immunogen | SRD5 A2 antibody was raised using the N terminal of SRD5 2 corresponding to a region with amino acids MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR |
Other Names | 3-oxo-5-alpha-steroid 4-dehydrogenase 2|5 alpha-SR2|S5AR 2|SR type 2|steroid 5-alpha-reductase 2|type II 5-alpha reductase|steroid 5 alpha-reductase 2|SRD5A2|Steroid-5-alpha-Reductase, alpha Polypeptide 2 (3-Oxo-5 alpha-Steroid delta 4-Dehydrogenase alpha 2)|5ART2|steroid 5 alpha reductase type2|prostatic steroid 5-alpha-reductase type II|SRD5alpha2|steroid-5-alpha-reductase|alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)|steroid-5-alpha-reductase alpha polypeptide 2|LOC100125532|zgc:112455|alpha polypeptide 2b|steroid-5-alpha-reductase, alpha polypeptide 2b|srd5a2b |
Gene, Accession # | Gene ID: 6716 |
Catalog # | ABIN635902 |
Price | $1020 |
Order / More Info | SRD5A2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |