Edit |   |
---|---|
Antigenic Specificity | RPL9 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat, zebrafish |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RPL9 polyclonal antibody, unconjugated |
Immunogen | RPL9 antibody was raised using the C terminal of RPL9 corresponding to a region with amino acids GVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIY |
Other Names | L9|NPC-A-16|60S ribosomal protein L9|ribosomal protein L9|RPL9|ribosomal protein L9-like|ab02c03|fa93a01|mg:ab02c03|wu:fa93a01|zgc:103730|ribosomal protein L9 L homeolog|rpl9.L|CG6141|DmelCG6141|M(2)32D|Rp L9|anon-EST:fe3A6|anon-WO0153538.25|anon-WO0153538.26|anon-WO0153538.27|CG6141-PA|CG6141-PB|RpL9-PA|RpL9-PB|anon-fast-evolving-3A6|rpl-9 |
Gene, Accession # | Gene ID: 6133, 20005, 29257, 336702, 479109 |
Catalog # | ABIN630013 |
Price | $902 |
Order / More Info | RPL9 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |