Edit |   |
---|---|
Antigenic Specificity | DUT |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-DUT polyclonal antibody, unconjugated |
Immunogen | DUT antibody was raised using the C terminal of DUT corresponding to a region with amino acids NFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN |
Other Names | dUTP pyrophosphatase|deoxyuridine 5'-triphosphate nucleotidohydrolase|mitochondrial|deoxyuridine triphosphatase|DUT|dUTPase|dUTP nucleotidohydrolase|BcDNA:LD08534|CG4584|DmelCG4584|LD08534|UTPase|anon-SAGE:Wang-077|CG4584-PA|CG4584-PB|CG4584-PC|CG4584-PD|dUTPase-PA|dUTPase-PB|dUTPase-PC|dUTPase-PD|5031412I06Rik|5133400F09Rik|D2Bwg0749e|Dutp|P18|dUTPase; ORF54; similar to EBV BLLF3, CMV UL72, HSV UL50|AlHV1gp51|UL50|HVT058|involved in nucleotide metabolism|ORF9|ORF8|tegument protein|U45|GAMMAHV.ORF54|Tc00.1047053509151.130|Tc00.1047053508175.160|Tb07.27E10.390|Tb927.7.5160|deoxyuridine triphosphatase L homeolog|dut.L|PIP4|PPAR-interacting protein 4|BLLF3 |
Gene, Accession # | Gene ID: 1854, 110074, 497778, 609526 |
Catalog # | ABIN629626 |
Price | $902 |
Order / More Info | DUT Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |