Edit |   |
---|---|
Antigenic Specificity | ESYT3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ESYT3 polyclonal antibody, unconjugated |
Immunogen | FAM62 C antibody was raised using a synthetic peptide corresponding to a region with amino acids RNRRGKLGRLAAAFEFLDNEREFISRELRGQHLPAWIHFPDVERVEWANK |
Other Names | CHR3SYT|E-Syt3|FAM62C|chr3 synaptotagmin|extended synaptotagmin-3|family with sequence similarity 62 (C2 domain containing)|member C|extended synaptotagmin 3|ESYT3|Extended Synaptotagmin-Like Protein 3|D930024E11|D9Ertd280e|mKIAA4186|family with sequence similarity 62|RGD1561304|fam62a|member A|extended synaptotagmin protein 3|im:7153182|si:ch211-219a4.7|DKFZp459I013|extended synaptotagmin-3-like|LOC100468549|LOC100594943 |
Gene, Accession # | Gene ID: 83850, 272636, 363120 |
Catalog # | ABIN635487 |
Price | $1020 |
Order / More Info | ESYT3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |