Edit |   |
---|---|
Antigenic Specificity | TNFAIP8L1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-TNFAIP8L1 polyclonal antibody, unconjugated |
Immunogen | TNFAIP8 L1 antibody was raised using the middle region of TNFAIP8 1 corresponding to a region with amino acids AKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL |
Other Names | 2600017J23Rik|TNF alpha-induced protein 8-like protein 1|TNFAIP8-like protein 1|tumor necrosis factor alpha-induced protein 8-like protein 1|tumor necrosis factor|alpha-induced protein 8-like protein 1|tumor necrosis factor, alpha-induced protein 8-like 1|Tnfaip8l1|TIPE1|TNF alpha induced protein 8 like 1|alpha-induced protein 8-like 1 |
Gene, Accession # | Gene ID: 126282 |
Catalog # | ABIN632217 |
Price | $1020 |
Order / More Info | TNFAIP8L1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |