Edit |   |
---|---|
Antigenic Specificity | KLRA1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-KLRA1 polyclonal antibody, unconjugated |
Immunogen | KLRA1 antibody was raised using the N terminal of KLRA1 corresponding to a region with amino acids NDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTL |
Other Names | Klra2|Ly49i8|Ly49 inhibitory receptor 8|killer cell lectin-like receptor 2|killer cell lectin-like receptor|subfamily A|member 2|killer cell lectin-like receptor, subfamily A, member 1|Klra1|A1|Klra22|Ly49a|Ly49o<129>|Ly49v|T-cell surface glycoprotein YE148|class I MHC receptor KLRA22|ly-49a|lymphocyte antigen 49a|natural killer cell receptor Ly49A|novel killer cell lectin-like receptor subfamily A protein|t lymphocyte antigen A1|LY49|killer cell lectin-like receptor subfamily A, member 1 |
Gene, Accession # | Gene ID: 10748 |
Catalog # | ABIN634535 |
Price | $1020 |
Order / More Info | KLRA1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |