Edit |   |
---|---|
Antigenic Specificity | FAD Synthetase |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-FAD Synthetase polyclonal antibody, unconjugated |
Immunogen | FLAD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGRSVTAGIIIVGDEILKGHTQDTNTFFLCRTLRSLGVQVCRVSVVPDEV |
Other Names | wu:fa92c06|zgc:91843|FAD pyrophosphorylase|FAD synthase|FAD synthetase|FMN adenylyltransferase|fa92c06|flavin adenine dinucleotide synthase|flavin adenine dinucleotide synthetase|flavin adenine dinucleotide synthetase 1|flad1|FAD synthetase (predicted)|SPCC1235.04c|GY4MC1_1590|SpiBuddy_1392|Psed_2275|Spico_0597|Trebr_1967|Geoth_1673|Ccan_14090|A930017E24Rik|Pp591|FAD-synthetase|FAD1|FADS|RP11-307C12.7|FAD1 flavin adenine dinucleotide synthetase homolog|homolog|flavin adenine dinucleotide synthetase 1 L homeolog|flad1.L |
Gene, Accession # | Gene ID: 80308, 319945, 751787 |
Catalog # | ABIN630740 |
Price | $1020 |
Order / More Info | FAD Synthetase Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |