Edit |   |
---|---|
Antigenic Specificity | BRK1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat, zebrafish |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-BRK1 polyclonal antibody, unconjugated |
Immunogen | C3 ORF10 antibody was raised using the middle region of C3 rf10 corresponding to a region with amino acids YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK |
Other Names | C3orf10|MDS027|hHBrk1|BRICK1|SCARWAVE actin-nucleating complex subunit|homolog|haematopoietic stemprogenitor cell protein 300|probable protein BRICK1|protein BRICK1|BRICK1, SCAR/WAVE actin nucleating complex subunit|BRK1|BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit|probable protein BRICK1-B|BRICK1, SCAR/WAVE actin-nucleating complex subunit S homeolog|brk1.S|6720456B07Rik|AW011779|C22H3orf10|GRMZM5G842058|brick 1|probable protein BRICK1-A|BRICK1, SCAR/WAVE actin-nucleating complex subunit L homeolog|brk1.L|ATBRK1|HSPC300|T9I22.8|T9I22_8 |
Gene, Accession # | Gene ID: 55845, 101314, 679934 |
Catalog # | ABIN629872 |
Price | $902 |
Order / More Info | BRK1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |