Edit |   |
---|---|
Antigenic Specificity | Sec8 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Sec8 polyclonal antibody, unconjugated |
Immunogen | EXOC4 antibody was raised using the N terminal of EXOC4 corresponding to a region with amino acids MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEA |
Other Names | SEC8|SEC8L1|Sec8p|SEC8-like 1|exocyst complex component Sec8|exocyst complex component 4|EXOC4|C78892|SEC8 protein|si:ch211-92l17.2|si:rp71-18a24.2|ATSEC8|SUBUNIT OF EXOCYST COMPLEX 8|CpipJ_CPIJ001354|DKFZp459N1430|ALR|augmenter of liver regeneration (ALR) pseudogene|rSec8|secretory protein SEC8|exocyst complex component 4 L homeolog|exoc4.L|sec-8|CG2095|DmelCG2095|dsec8|fun|CG2095-PA|funnel cakes|sec8-PA|Secretory 8|exocyst complex subunit Sec8 |
Gene, Accession # | Gene ID: 20336, 60412, 116654 |
Catalog # | ABIN631432 |
Price | $1020 |
Order / More Info | Sec8 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |