Edit |   |
---|---|
Antigenic Specificity | MMADHC |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-MMADHC polyclonal antibody, unconjugated |
Immunogen | C2 ORF25 antibody was raised using the middle region of C2 rf25 corresponding to a region with amino acids RAEGYWADFIDPSSGLAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKVI |
Other Names | C2orf25|CL25022|cblD|methylmalonic aciduria and homocystinuria type D protein|mitochondrial|protein C2orf25|methylmalonic aciduria and homocystinuria, cblD type|MMADHC|Methylmalonic Aciduria (Cobalamin Deficiency) CblD Type, with Homocystinuria|methylmalonic aciduria and homocystinuria type D homolog|2010311D03Rik|AI314967|likely ortholog of H. sapiens chromosome 2 open reading frame 25 (C2orf25)|RGD1303272 |
Gene, Accession # | Gene ID: 27249, 109129, 362134 |
Catalog # | ABIN631034 |
Price | $1020 |
Order / More Info | MMADHC Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |