Edit |   |
---|---|
Antigenic Specificity | KIF1C |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-KIF1C polyclonal antibody, unconjugated |
Immunogen | KIF1 C antibody was raised using the C terminal of KIF1 corresponding to a region with amino acids GGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPYTTPP |
Other Names | LTXS1|kinesin-like protein KIF1C|kinesin family member 1C|KIF1C|kinesin 1C|kinesin-like protein KIF1D|DKFZp468E0822|kinesin-like protein KIF1C-like|B430105J22Rik|D11Bwg1349e|N-3 kinsin|kinesin superfamily protein 1C|lethal factor toxin susceptibility 1 |
Gene, Accession # | Gene ID: 10749, 489453 |
Catalog # | ABIN630184 |
Price | $902 |
Order / More Info | KIF1C Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |