Edit |   |
---|---|
Antigenic Specificity | MAPK12 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-MAPK12 polyclonal antibody, unconjugated |
Immunogen | MAPK12 antibody was raised using the N terminal of MAPK12 corresponding to a region with amino acids SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE |
Other Names | ERK3|ERK6|P38GAMMA|PRKM12|SAPK-3|SAPK3|ERK-6|MAP kinase 12|MAP kinase p38 gamma|MAPK 12|extracellular signal-regulated kinase 6|mitogen-activated protein kinase 3|mitogen-activated protein kinase p38 gamma|stress-activated protein kinase 3|mitogen-activated protein kinase 12|MAPK12|etID309866.18|wu:fa05c12|zgc:101695|fa05c12|p38-gamma|mitogen-activated protein kinase 12a|mapk12a|MGC160082|si:dkey-14d8.5|mitogen-activated protein kinase 12b|mapk12b|ATMPK12|T3F17.28|MPK12|AW123708|mitogen activated protein kinase 12|stress activated protein kinase 3|SAP kinase-3|LOW QUALITY PROTEIN: mitogen-activated protein kinase 12|Xp38gamma|SAPK3 protein kinase|Xp38gammaSAPK3 protein kinase|mitogen-activated protein kinase 12 S homeolog|mapk12.S |
Gene, Accession # | Gene ID: 6300, 29857, 60352 |
Catalog # | ABIN634255 |
Price | $1020 |
Order / More Info | MAPK12 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |