Edit |   |
---|---|
Antigenic Specificity | Retinoid X Receptor beta |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Retinoid X Receptor beta polyclonal antibody, unconjugated |
Immunogen | RXRB antibody was raised using the N terminal of RXRB corresponding to a region with amino acids MHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGRDGMGDSG |
Other Names | DAUDI6|H-2RIIBP|NR2B2|RCoR-1|MHC class I promoter binding protein|nuclear receptor subfamily 2 group B member 2|retinoic acid receptor RXR-beta|retinoid X receptor beta|RXRB|Retinoid X Receptor, beta|RXR-beta|nuclear receptor co-regulator 1|nuclear receptor coregulator 1|retinoic acid receptor|beta|RXRbeta|xRXR beta|retinoid X receptor beta S homeolog|rxrb.S|retinoid X receptor|NR2B2-A|RXR|RXRA|etID309733.19|rxre|wu:fb93c09|fb93c09|nuclear receptor subfamily 2 group B member 2-A|retinoic acid receptor RXR-beta-A|retinoid X receptor beta-A|retinoid receptor-epsilon|epsilon|retinoid x receptor, beta a|rxrba|AL023085|Rub|MHC class I regulatory element-binding protein H-2RIIBP|rxrd|unp286|NR2B2-B|nuclear receptor subfamily 2 group B member 2-B|retinoic acid receptor RXR-beta-B|retinoic acid receptor RXR-delta|retinoid X receptor beta-B|retinoid X receptor delta|retinoid receptor-delta|delta|retinoid x receptor, beta b|rxrbb |
Gene, Accession # | Gene ID: 6257 |
Catalog # | ABIN630492 |
Price | $1020 |
Order / More Info | Retinoid X Receptor beta Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |