Edit |   |
---|---|
Antigenic Specificity | DDX6 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-DDX6 polyclonal antibody, unconjugated |
Immunogen | DDX6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ |
Other Names | HLR2|P54|RCK|ATP-dependent RNA helicase p54|DEAD (Asp-Glu-Ala-Asp) box polypeptide 6|DEAD box protein 6|DEAD box-6|DEADH (Asp-Glu-Ala-AspHis) box polypeptide 6 (RNA helicase|54kD)|oncogene RCK|probable ATP-dependent RNA helicase DDX6|DEAD-box helicase 6|DDX6|RGD1564560|si:ch211-147p17.1|DEAD (Asp-Glu-Ala-Asp) box helicase 6|P54H|Xp54|me31b|RNA helicase p54|1110001P04Rik|E230023J21Rik|mRCKP54|D-E-A-D (aspartate-glutamate-alanine-aspartate) box polypeptide 6|DEAD (aspartate-glutamate-alanine-aspartate) box polypeptide 6|DEADH (Asp-Glu-Ala-AspHis) box polypeptide 6|oncogene RCK homolog|ATP-dependent RNA helicase ddx6|DEAD-box helicase 6 L homeolog|ddx6.L |
Gene, Accession # | Gene ID: 1656, 13209, 479414, 500988 |
Catalog # | ABIN629973 |
Price | $902 |
Order / More Info | DDX6 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |