Edit |   |
---|---|
Antigenic Specificity | FICD |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-FICD polyclonal antibody, unconjugated |
Immunogen | FICD antibody was raised using the C terminal Of Ficd corresponding to a region with amino acids FAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYY |
Other Names | HIP13|HYPE|UNQ3041|AMPylator FICD|FIC domain-containing protein|HIP-13|Huntingtin interacting protein E|adenosine monophosphate-protein transferase FICD|fic S-phase protein cell division homolog|huntingtin interacting protein 13|huntingtin interactor protein E|huntingtin yeast partner E|huntingtin-interacting protein 13|huntingtin-interacting protein E|FIC domain containing|FICD|D5Ertd40e|fk44h08|si:ch211-191d15.5|wu:fk44h08|zgc:110336 |
Gene, Accession # | Gene ID: 11153, 231630, 288741, 486320 |
Catalog # | ABIN630209 |
Price | $902 |
Order / More Info | FICD Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |