Edit |   |
---|---|
Antigenic Specificity | CHRFAM7A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat, zebrafish |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CHRFAM7A polyclonal antibody, unconjugated |
Immunogen | CHRFAM7 A antibody was raised using the N terminal of CHRFAM7 corresponding to a region with amino acids QFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSC |
Other Names | CHRNA7|CHRNA7-DR1|D-10|CHRNA7 (cholinergic receptor|nicotinic|alpha polypeptide 7|exons 5-10) and FAM7A (family with sequence similarity 7A|exons A-E) fusion|CHRNA7-FAM7A fusion protein|alpha 7 neuronal nicotinic acetylcholine receptor-FAM7A hybrid|alpha-7 nicotinic cholinergic receptor subunit|CHRNA7 (exons 5-10) and FAM7A (exons A-E) fusion|CHRFAM7A|CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7, Exons 5-10) and FAM7A (Family with Sequence Similarity 7A, Exons A-E) Fusion |
Gene, Accession # | Gene ID: 89832 |
Catalog # | ABIN633716 |
Price | $1020 |
Order / More Info | CHRFAM7A Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |