Edit |   |
---|---|
Antigenic Specificity | Connexin 43/GJA1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Connexin 43/GJA1 polyclonal antibody, unconjugated |
Immunogen | GJA1 antibody was raised using the N terminal of GJA1 corresponding to a region with amino acids LYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVDMHLKQIEIKKFKYGIE |
Other Names | AVSD3|CX43|DFNB38|GJAL|HLHS1|HSS|ODDD|connexin 43|connexin-43|gap junction 43 kDa heart protein|gap junction alpha-1 protein|gap junction protein alpha 1|GJA1|Gap Junction Protein, alpha 1, 43kDa|Connexin 43/GJA1|gap junction membrane channel protein alpha 1|gap junction protein, alpha 1|AU042049|AW546267|Cnx43|Cx43alpha1|Gja-1|Npm1|connexin43|alpha 1 connexin|cx43a1|zfCx43.3|etID309742.9|gap junction protein|alpha 1|shf|short fin protein|sof|43 kD (connexin 43)|vascular smooth muscle connexin-43|gja1-A|alpha 1 gap junction protein|gap junction protein alpha 1 L homeolog|gja1.L|43kDa (connexin 43)|CONNEXIN 43 protein |
Gene, Accession # | Gene ID: 2697, 14609, 24392, 403418 |
Catalog # | ABIN634661 |
Price | $1020 |
Order / More Info | Connexin 43/GJA1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |