Edit |   |
---|---|
Antigenic Specificity | FCN3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-FCN3 polyclonal antibody, unconjugated |
Immunogen | FCN3 antibody was raised using the N terminal of FCN3 corresponding to a region with amino acids LEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLL |
Other Names | FCNH|HAKA1|H-ficolin|collagenfibrinogen domain-containing lectin 3 p35|collagenfibrinogen domain-containing protein 3|ficolin 3|ficolin-3|FCN3|Ficolin (Collagen/fibrinogen Domain Containing) 3 (Hakata Antigen)|ficolin (collagenfibrinogen domain containing) 3 (Hakata antigen)|LOW QUALITY PROTEIN: ficolin-3|fcn3-A |
Gene, Accession # | Gene ID: 8547 |
Catalog # | ABIN634029 |
Price | $1020 |
Order / More Info | FCN3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |