Edit |   |
---|---|
Antigenic Specificity | NUP155 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-NUP155 polyclonal antibody, unconjugated |
Immunogen | NUP155 antibody was raised using the N terminal of NUP155 corresponding to a region with amino acids MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVS |
Other Names | N155|155 kDa nucleoporin|nuclear pore complex protein Nup155|nucleoporin 155|NUP155|Nucleoporin 155kDa|P140|nucleoporin 155kD|nucleoporin Nup155|D930027M19Rik|mKIAA0791|nucleoporin 155kDa L homeolog|nup155.L|zgc:55435|F10B6.25|F10B6_25|nuclear pore protein|DDBDRAFT_0189286|DDBDRAFT_0235243|DDB_0189286|DDB_0235243|nuclear pore complex protein Nup155-like|LOW QUALITY PROTEIN: nuclear pore complex protein Nup155 |
Gene, Accession # | Gene ID: 9631, 117021, 170762 |
Catalog # | ABIN631629 |
Price | $1020 |
Order / More Info | NUP155 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |