Edit |   |
---|---|
Antigenic Specificity | GSTM1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-GSTM1 polyclonal antibody, unconjugated |
Immunogen | GSTM1 antibody was raised using the N terminal of GSTM1 corresponding to a region with amino acids KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI |
Other Names | GST1|GSTM1-1|GSTM1a-1a|GSTM1b-1b|GTH4|GTM1|H-B|MU|MU-1|GST HB subunit 4|GST class-mu 1|HB subunit 4|S-(hydroxyalkyl)glutathione lyase|glutathione S-alkyltransferase|glutathione S-aralkyltransferase|glutathione S-aryltransferase|glutathione S-transferase M1|glutathione S-transferase Mu 1|GSTM1|GSTA3|GST 3-3|GST Yb1|glutathione S-transferase Yb-1 subunit|glutathione-S-transferase mu type 1 (Yb1)|glutathione-S-transferase|mu type 1 (Yb1)|Gstb-1|Gstb1|GST 1-1|glutathione S-transferase GT8.7|mu 1|pmGT10|glutathione S-transferase, mu 1|LOC100356307|LOC100731426|gst-mu|gstm2|glutathione S-transferase mu 2|glutathione S-transferase|mu 2|glutathione S-transferase mu 1 L homeolog|gstm1.L |
Gene, Accession # | Gene ID: 2944, 14862, 24423, 479912 |
Catalog # | ABIN633921 |
Price | $1020 |
Order / More Info | GSTM1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |