Edit |   |
---|---|
Antigenic Specificity | ASF1B |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ASF1B polyclonal antibody, unconjugated |
Immunogen | ASF1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH |
Other Names | CIA-II|ASF1 anti-silencing function 1 homolog B|CCG1-interacting factor A-II|anti-silencing function protein 1 homolog B|hAsf1|hAsf1b|hCIA-II|histone chaperone ASF1B|anti-silencing function 1B histone chaperone|ASF1B|asf1-b|asf1a|asf1a-b|asf1ab|ASF1 anti-silencing function 1 homolog A|anti-silencing function protein 1 homolog A-B|anti-silencing function protein 1-B|histone chaperone asf1-B|histone chaperone asf1a-B|anti-silencing function 1B histone chaperone L homeolog|asf1b.L|1700003K02Rik|AA409591|mCIA-II|fc68a10|wu:fc68a10|zgc:77178|anti-silencing function protein 1 homolog Ba|histone chaperone asf1b-A|anti-silencing function 1Ba histone chaperone|asf1ba|ASF1 anti-silencing function 1 homolog B (S. cerevisiae)|anti-silencing function 1B|F16F17.110|F16F17_110|SGA01|SGA1|anti- silencing function 1b|LOC9304878|MGC89345|asf1|histone chaperone asf1|asb1bb|wu:fb20g03|zgc:76977|anti-silencing function protein 1 homolog Bb|anti-silencing function protein 1-A|histone chaperone asf1-A|histone chaperone asf1b-B|anti-silencing function 1Bb histone chaperone|asf1bb |
Gene, Accession # | Gene ID: 55723, 66929, 304648, 484905 |
Catalog # | ABIN630638 |
Price | $1020 |
Order / More Info | ASF1B Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |