Edit |   |
---|---|
Antigenic Specificity | PDZK1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-PDZK1 polyclonal antibody, unconjugated |
Immunogen | PDZK1 antibody was raised using the N terminal of PDZK1 corresponding to a region with amino acids MTSTFNPRECKLSKQEGQNYGFFLRIEKDTEGHLVRVVEKCSPAEKAGLQ |
Other Names | CAP70|CLAMP|NHERF-3|NHERF3|PDZD1|CFTR-associated protein of 70 kDa|Na(+)H(+) exchange regulatory cofactor NHE-RF3|PDZ-containing kidney protein 1|naPi cotransporter C-terminal-associated protein 1|naPi-Cap1|sodium-hydrogen exchanger regulatory factor 3|PDZ domain containing 1|PDZK1|1700023D20Rik|2610507N21Rik|4921513F16Rik|AI267131|AI314638|AL022680|D3Ertd537e|mPDZK1|Na(+)H(+) exchanger regulatory factor 3|PDZ domain-containing protein 1|C-terminal linking and modulating protein|C-terminal-linking and modulating protein|dietary Pi-regulated RNA-1|diphor-1|xpdzk1|PDZ domain containing 1 L homeolog|pdzk1.L|PDZK1-like protein|Na(+)H(+) exchange regulatory cofactor NHE-RF3-like|cb1074|pdzk1l|wu:fa55e12|wu:fb65e01|PDZ domain containing 1 like |
Gene, Accession # | Gene ID: 5174, 59020 |
Catalog # | ABIN631670 |
Price | $1020 |
Order / More Info | PDZK1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |