Edit |   |
---|---|
Antigenic Specificity | K-RAS |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | Drosophila melanogaster, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-K-RAS polyclonal antibody, unconjugated |
Immunogen | KRAS antibody was raised using the N terminal of KRAS corresponding to a region with amino acids TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC |
Other Names | KRAS proto-oncogene, GTPase|KRAS|GTPase Kras|K-RAS|wu:fa04e08|wu:fc14b12|wu:fc23g10|wu:fj89d12|zgc:85725|fa04e08|fc14b12|fc23g10|fj89d12|xRAS2|v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog|Kras2|c-Ki-ras|p21|K-Ras 2|Kirsten rat sarcoma viral oncogene homologue 2 (active)|c-K-ras|c-K-ras2 protein|c-Kirsten-ras proto-oncogene|ki-Ras|CFC2|K-RAS2A|K-RAS2B|K-RAS4A|K-RAS4B|KRAS1|NS|NS3|RASK2|K-ras p21 protein|PR310 c-K-ras oncogene|c-Kirsten-ras protein|cellular c-Ki-ras2 proto-oncogene|oncogene KRAS2|transforming protein p21|v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog|AI929937|Kras-2|p21B|ras|Kirsten rat sarcoma oncogene 2|expressed|p21 protein|Kirsten rat sarcoma viral oncogene homolog|semicolonial-7|smco-7|Ras family protein|PGTG_03066|Tsp_02666|Tsp_01642|rask|kras-a|kras-b|Kirsten rat sarcoma viral oncogene homolog S homeolog|ras protein|kras.S|ras p21|p21ras|Kirsten rat sarcoma viral (Kras-2) oncogene homolog |
Gene, Accession # | Gene ID: 3845, 16653, 24525 |
Catalog # | ABIN634246 |
Price | $1020 |
Order / More Info | K-RAS Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |