Edit |   |
---|---|
Antigenic Specificity | CYP20A1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CYP20A1 polyclonal antibody, unconjugated |
Immunogen | CYP20 A1 antibody was raised using the N terminal of CYP20 1 corresponding to a region with amino acids ITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTV |
Other Names | CYP-M|cytochrome P450 20A1|cytochrome P450 monooxygenase|cytochrome P450 family 20 subfamily A member 1|CYP20A1|Cytochrome P450, Family 20, Subfamily A, Polypeptide 1|A930011N14Rik|Cypm|cytochrome P450|20a1|wu:fa10c06|zgc:63986|cytochrome P450 family 20 subfamily A member 1 L homeolog|cyp20a1.L |
Gene, Accession # | Gene ID: 57404, 77951, 316435 |
Catalog # | ABIN636079 |
Price | $1020 |
Order / More Info | CYP20A1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |