Edit |   |
---|---|
Antigenic Specificity | CLIC5 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CLIC5 polyclonal antibody, unconjugated |
Immunogen | CLIC5 antibody was raised using the C terminal of CLIC5 corresponding to a region with amino acids YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS |
Other Names | MST130|MSTP130|chloride intracellular channel protein 5|chloride intracellular channel 5|CLIC5|5730531E12Rik|B330005L24|Gm322|jbg|chloride channel protein p64|chlorine channel protein p64|im:6907594|zgc:77538|chloride intracellular channel 5b|clic5b|zgc:101827|chloride intracellular channel protein 6|chloride intracellular channel 5a|clic5a|chloride intracellular channel 5 L homeolog|clic5.L|chloride intracellular channel protein 5-like |
Gene, Accession # | Gene ID: 53405 |
Catalog # | ABIN630075 |
Price | $902 |
Order / More Info | CLIC5 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |