Edit |   |
---|---|
Antigenic Specificity | Synaptophysin |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Synaptophysin polyclonal antibody, unconjugated |
Immunogen | Synaptophysin antibody was raised using the N terminal of SYP corresponding to a region with amino acids MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGE |
Other Names | MRXSYP|major synaptic vesicle protein P38|synaptophysin|SYP|A230093K24Rik|AI848995|Syn|p38|BM89 antigen|Syp I|Syp1|xsypi|synaptophysin L homeolog|syp.L|MGC86267|syp-B|xsypii|synaptophysin S homeolog|syp.S|synaptophysin a|sypa |
Gene, Accession # | Gene ID: 6855, 20977, 24804 |
Catalog # | ABIN635142 |
Price | $1020 |
Order / More Info | Synaptophysin Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |