Edit |   |
---|---|
Antigenic Specificity | RNF170 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RNF170 polyclonal antibody, unconjugated |
Immunogen | RNF170 antibody was raised using the C terminal of RNF170 corresponding to a region with amino acids FYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR |
Other Names | SNAX1|E3 ubiquitin-protein ligase RNF170|putative LAG1-interacting protein|ring finger protein 170|RNF170|6720407G21Rik|AI481227|ring finger protein 170 L homeolog|rnf170.L|microRNA 4469|MIR4469|zgc:65779|zgc:76995|RING-type E3 ubiquitin transferase RNF170 |
Gene, Accession # | Gene ID: 77733, 81790 |
Catalog # | ABIN634858 |
Price | $1020 |
Order / More Info | RNF170 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |