Edit |   |
---|---|
Antigenic Specificity | PABPC5 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-PABPC5 polyclonal antibody, unconjugated |
Immunogen | PABPC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLDKSIDNR |
Other Names | C820015E17|polyadenylate-binding protein 5|poly(A) binding protein, cytoplasmic 5|Pabpc5|PABP5|poly(A) binding protein cytoplasmic 5|PABP-5|poly(A)-binding protein 5|poly(A)-binding protein cytoplasmic 5|poly(A) binding protein|cytoplasmic 5|polyadenylate-binding protein 5-like|poly A binding protein|cytoplasmic 5-like|poly A binding protein, cytoplasmic 5 |
Gene, Accession # | Gene ID: 93728, 140886 |
Catalog # | ABIN633413 |
Price | $1020 |
Order / More Info | PABPC5 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |