Edit |   |
---|---|
Antigenic Specificity | FAM71A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-FAM71A polyclonal antibody, unconjugated |
Immunogen | FAM71 A antibody was raised using the C terminal of FAM71 corresponding to a region with amino acids DKIAQKSSSRSSFSHRANRDDKKEKGCGNPGSSRHRDSHKGVSHTPISKE |
Other Names | RP11-338C15.4|protein FAM71A|family with sequence similarity 71 member A|FAM71A|Family with Sequence Similarity 71, Member A|RGD1561646|uncharacterized protein LOC498311|4933417M04Rik|GARI-L4|Golgi-associated Rab2B interactor-like 4|uncharacterized protein LOC619288 |
Gene, Accession # | Gene ID: 149647 |
Catalog # | ABIN632763 |
Price | $1020 |
Order / More Info | FAM71A Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |