Edit |   |
---|---|
Antigenic Specificity | AADACL4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-AADACL4 polyclonal antibody, unconjugated |
Immunogen | AADACL4 antibody was raised using the N terminal of AADACL4 corresponding to a region with amino acids FIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHG |
Other Names | arylacetamide deacetylase like 4|AADACL4|Arylacetamide Deacetylase-Like 4|arylacetamide deacetylase-like 4 S homeolog|aadacl4.S|RGD1565761|arylacetamide deacetylase-like 4-like 3|AADACL4L3|OTTMUSG00000010747|LOC100218769|LOC100713568 |
Gene, Accession # | Gene ID: 343066 |
Catalog # | ABIN635244 |
Price | $1020 |
Order / More Info | AADACL4 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |