Edit |   |
---|---|
Antigenic Specificity | FAM62B |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-FAM62B polyclonal antibody, unconjugated |
Immunogen | FAM62 B antibody was raised using a synthetic peptide corresponding to a region with amino acids NSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKS |
Other Names | CHR2SYT|E-Syt2|FAM62B|chr2 synaptotagmin|extended synaptotagmin-2|family with sequence similarity 62 (C2 domain containing)|member B|extended synaptotagmin 2|ESYT2|2410017M09Rik|4921504I16Rik|D12Ertd551e|family with sequence similarity 62|extended synaptotagmin-like protein 2|E-Syt2-A|extended synaptotagmin-2-A|extended synaptotagmin-like protein 2 S homeolog|esyt2.S |
Gene, Accession # | Gene ID: 52635, 57488 |
Catalog # | ABIN635474 |
Price | $1020 |
Order / More Info | FAM62B Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |