Edit |   |
---|---|
Antigenic Specificity | CARS |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CARS polyclonal antibody, unconjugated |
Immunogen | CARS antibody was raised using the C terminal of CARS corresponding to a region with amino acids KRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHD |
Other Names | cysRS|cysteine--tRNA ligase|cytoplasmic|cysteine-tRNA ligase|cysteinyl-tRNA synthetase|CARS|sb:cb71|cysteinyl-tRNA synthetase S homeolog|cars.S|CARS1|MGC:11246|cysteine tRNA ligase 1|cysteine translase|CA3|BcDNA:LD21177|CG8431|CRS|DmelCG8431|Aats-cys-PA|CG8431-PA|BA0089|cysS|APH_RS02395|DDBDRAFT_0215191|DDBDRAFT_0231320|DDB_0215191|DDB_0231320|mcysS|DDBDRAFT_0187313|DDBDRAFT_0231318|DDB_0187313|DDB_0231318|T16B12.16|Cysteinyl-tRNA synthetase, class Ia family protein|SYCO ARATH|AT3G56300|K15E6.3|K15E6_3|AT5G38830|cysteinyl-tRNA synthetase CysS |
Gene, Accession # | Gene ID: 833 |
Catalog # | ABIN633577 |
Price | $1020 |
Order / More Info | CARS Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |