Edit |   |
---|---|
Antigenic Specificity | GAPDH |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-GAPDH polyclonal antibody, unconjugated |
Immunogen | GAPDH antibody was raised using the N terminal of GAPDH corresponding to a region with amino acids IDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKW |
Other Names | G3PD|GAPD|aging-associated gene 9 protein|peptidyl-cysteine S-nitrosylase GAPDH|glyceraldehyde-3-phosphate dehydrogenase|GAPDH|38 kDa BFA-dependent ADP-ribosylation substrate|BARS-38|BEST:GH12586|CG12055|DmelCG12055|GA3PDH|GADPH|GAP|GAPDH I|GAPDH-1|GAPDH1|GAPDHI|Gapdh43E|gh12586|CG12055-PA|CG12055-PB|G3-P dehydrogenase|Gapdh1-PA|Gapdh1-PB|Glyceraldehyde-3-phosphate dehydrogenase1|glyceraldehyde 3 phosphate dehydrogenase|glyceraldehyde 3 phosphate dehydrogenase 1|glyceraldehyde 3 phosphate dehydrogenase1|glyceraldehyde phosphate dehydrogenase|cb609|mg:bb02e05|wu:fb33a10|wu:ft80f05|bb02e05|KNC-NDS6|G3PDH|glyceraldehyde-3-phosphate dehydrogenase S homeolog|gapdh.S|type I|glyceraldehyde-3-phosphate dehydrogenase, type I|glyceraldehyde-3-phosphate dehydrogenase-like|LOC100404960|olfactory receptor 8K3|LOC614985 |
Gene, Accession # | Gene ID: 2597, 403755 |
Catalog # | ABIN630723 |
Price | $1020 |
Order / More Info | GAPDH Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |