Edit |   |
---|---|
Antigenic Specificity | DONSON |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-DONSON polyclonal antibody, unconjugated |
Immunogen | DONSON antibody was raised using the middle region of DONSON corresponding to a region with amino acids DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE |
Other Names | B17|C21orf60|C2TA|MHC class II transactivator type I|protein downstream neighbor of Son|downstream neighbor of SON|DONSON|CpipJ_CPIJ018445|1110025J21Rik|AI845729|ORF60|protein 3SG|MGC76196|protein downstream neighbor of son homolog|LOC478407|downstream neighbor of SON L homeolog|donson.L |
Gene, Accession # | Gene ID: 60364 |
Catalog # | ABIN630570 |
Price | $1020 |
Order / More Info | DONSON Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |